PDB entry 2yy2

View 2yy2 on RCSB PDB site
Description: Crystal structure of the human Phosphodiesterase 9A catalytic domain complexed with IBMX
Class: hydrolase
Keywords: catalytic domain, phosphodiesterase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-04-27, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yy2a_
  • Chain 'B':
    Compound: High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yy2b_
  • Heterogens: ZN, MG, IBM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yy2A (A:)
    gssgssgptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpv
    tlrrwlfcvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichd
    ldhpgynntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqir
    qgmitlilatdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmeva
    epwvdclleeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfp
    mveeimlqplwesrdryeelkriddamkelqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy2A (A:)
    ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
    cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
    ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
    latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
    leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
    qplwesrdryeelkriddamkelqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yy2B (B:)
    gssgssgptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpv
    tlrrwlfcvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichd
    ldhpgynntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqir
    qgmitlilatdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmeva
    epwvdclleeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfp
    mveeimlqplwesrdryeelkriddamkelqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy2B (B:)
    ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
    cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
    ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
    latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
    leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
    qplwesrdryeelkriddamkelq