PDB entry 2yy1

View 2yy1 on RCSB PDB site
Description: Crystal structure of N-terminal domain of human galectin-9 containing L-acetyllactosamine
Class: sugar binding protein
Keywords: suger binding, galectin, human, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2007-04-27, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yy1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yy1A (A:)
    gssgssgmafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgf
    sgndiafhfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvm
    vngilfvqyfhrvpfhrvdtisvngsvqlsyisfsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy1A (A:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisf