PDB entry 2yxr

View 2yxr on RCSB PDB site
Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal
Class: protein transport
Keywords: translocon, protein translocation, signal peptide, membrane protein, protein secretion, prl mutation, PROTEIN TRANSPORT
Deposited on 2007-04-27, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.3
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Preprotein translocase subunit secY
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: SECY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60175
    • see remark 999 (56)
• Chain 'B':
  Compound: Preprotein translocase subunit secE
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: secE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57817
  Domains in SCOPe 2.05: d2yxrb1
• Chain 'C':
  Compound: Preprotein translocase secG subunit
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: secG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60460
  Domains in SCOPe 2.05: d2yxrc1

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2yxrB (B:)
  mktdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpat
  yikgilkppttprv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yxrB (B:)
  tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
  kgilk
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2yxrC (C:)
  mskreetglatsaglirymdetfskirvkpehvigvtvafviieailtygrfl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yxrC (C:)
  etfskirvkpehvigvtvafviieailtygrf