PDB entry 2yxq
View 2yxq on RCSB PDB site
Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal
Class: protein transport
Keywords: protein translocation, signal peptide, membrane protein, protein secretion, prl mutation, PROTEIN TRANSPORT
Deposited on
2007-04-27, released
2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.301
AEROSPACI score: 0.08
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Preprotein translocase subunit secY
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: SECY
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Preprotein translocase subunit secE
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: secE
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2yxqb1 - Chain 'C':
Compound: Preprotein translocase secG subunit
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: secG
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2yxqc1
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2yxqB (B:)
mktdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpat
yikgilkppttprv
Sequence, based on observed residues (ATOM records): (download)
>2yxqB (B:)
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2yxqC (C:)
mskreetglatsaglirymdetfskirvkpehvigvtvafviieailtygrfl
Sequence, based on observed residues (ATOM records): (download)
>2yxqC (C:)
etfskirvkpehvigvtvafviieailtygrf