PDB entry 2yxq

View 2yxq on RCSB PDB site
Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal
Class: protein transport
Keywords: protein translocation, signal peptide, membrane protein, protein secretion, prl mutation, PROTEIN TRANSPORT
Deposited on 2007-04-27, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.301
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase subunit secY
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: SECY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60175
      • see remark 999 (59)
  • Chain 'B':
    Compound: Preprotein translocase subunit secE
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: secE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yxqb1
  • Chain 'C':
    Compound: Preprotein translocase secG subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: secG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yxqc1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yxqB (B:)
    mktdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpat
    yikgilkppttprv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yxqB (B:)
    tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
    kgilk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yxqC (C:)
    mskreetglatsaglirymdetfskirvkpehvigvtvafviieailtygrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yxqC (C:)
    etfskirvkpehvigvtvafviieailtygrf