PDB entry 2yxp

View 2yxp on RCSB PDB site
Description: The Effect of Deuteration on Protein Structure A High Resolution Comparison of Hydrogenous and Perdeuterated Haloalkane Dehalogenase
Class: hydrolase
Keywords: protein deuteration, haloalkane dehalogenase, high resolution structure,catalytic mechanism, HYDROLASE
Deposited on 2007-04-27, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.16
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: haloalkane dehalogenase
    Species: Xanthobacter autotrophicus [TaxId:280]
    Gene: dhlA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yxpx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yxpX (X:)
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete