PDB entry 2yxn

View 2yxn on RCSB PDB site
Description: Structual basis of azido-tyrosine recognition by engineered bacterial Tyrosyl-tRNA synthetase
Class: ligase
Keywords: TRNA Synthetases Class I, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-04-26, released 2008-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Escherichia coli [TaxId:316407]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGJ9 (0-321)
      • engineered (36)
      • engineered (194)
    Domains in SCOPe 2.06: d2yxna_
  • Heterogens: AZY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yxnA (A:)
    massnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkr
    fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
    aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
    ydfaclnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
    ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
    yvlaeqvtrlvhgeeglqaakr