PDB entry 2yxn

View 2yxn on RCSB PDB site
Description: Structual basis of azido-tyrosine recognition by engineered bacterial Tyrosyl-tRNA synthetase
Class: ligase
Keywords: TRNA Synthetases Class I, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-04-26, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosyl-tRNA synthetase
  Species: Escherichia coli [TaxId:316407]
  Gene: tyrS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AGJ9 (0-321)
    • engineered (36)
    • engineered (194)
  Domains in SCOPe 2.08: d2yxna_
• Heterogens: AZY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yxnA (A:)
  massnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkr
  fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
  aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
  ydfaclnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
  ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
  yvlaeqvtrlvhgeeglqaakr