PDB entry 2yxm
View 2yxm on RCSB PDB site
Description: Crystal structure of I-set domain of human Myosin Binding ProteinC
Class: cell adhesion
Keywords: I-set domain, Myosin binding Protein C, Cytoskeleton, cell adhesionn, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on
2007-04-26, released
2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.196
AEROSPACI score: 0.62
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Myosin-binding protein C, slow-type
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2yxma1, d2yxma2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2yxmA (A:)
gssgssgaafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkg
cqrilfinncqmtddseyyvtagdekcstelfvrsgpssg
Sequence, based on observed residues (ATOM records): (download)
>2yxmA (A:)
sgssgaafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkgcq
rilfinncqmtddseyyvtagdekcstelfvr