PDB entry 2yxm

View 2yxm on RCSB PDB site
Description: Crystal structure of I-set domain of human Myosin Binding ProteinC
Class: cell adhesion
Keywords: I-set domain, Myosin binding Protein C, Cytoskeleton, cell adhesionn, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-26, released 2007-10-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, slow-type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00872 (7-93)
      • expression tag (2-6)
    Domains in SCOPe 2.04: d2yxma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yxmA (A:)
    gssgssgaafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkg
    cqrilfinncqmtddseyyvtagdekcstelfvrsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yxmA (A:)
    sgssgaafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkgcq
    rilfinncqmtddseyyvtagdekcstelfvr