PDB entry 2yxc

View 2yxc on RCSB PDB site
Description: The H25M mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: electron transport
Deposited on 2007-04-26, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.178
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-106)
      • engineered (24)
    Domains in SCOPe 2.08: d2yxca_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yxcA (A:)
    apkapadglkmdktkqpvvfnhstmkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs