PDB entry 2yx5

View 2yx5 on RCSB PDB site
Description: Crystal Structure of Methanocaldococcus jannaschii PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway
Class: structural genomics, unknown function
Keywords: anti parallel beta sheet, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-04-24, released 2007-10-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0062 protein MJ1593
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yx5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yx5A (A:)
    mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimegeneekvkeeve
    emckkllanpvihdyeikvekie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yx5A (A:)
    mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimeeneekvkeevee
    mckkllanpvihdyeikvekie