PDB entry 2yx4

View 2yx4 on RCSB PDB site
Description: Crystal Structure of T134A of ST1022 from Sulfolobus tokodaii
Class: transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-04-24, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.251
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 150aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1022
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972W6 (0-149)
      • engineered (133)
    Domains in SCOPe 2.08: d2yx4a1, d2yx4a2
  • Heterogens: MG, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yx4A (A:)
    mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
    ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
    ervmsipevertsaqvvvkiikespnivif