PDB entry 2ywl

View 2ywl on RCSB PDB site
Description: crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Deposited on 2007-04-20, released 2007-10-23
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase related protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: thioredoxin reductase related protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ywlA (A:)
mwdvivvgggpsglsaalflaraglkvlvldggrskvkgvsrvpnypglldepsgeellr
rleaharrygaevrpgvvkgvrdmggvfeveteegvekaerlllcthkdptlpsllgltr
rgayidtdeggrtsyprvyaagvargkvpghaiisagdgayvavhlvsdlrgepykdhal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2ywlB (B:)
mwdvivvgggpsglsaalflaraglkvlvldggrskvkgvsrvpnypglldepsgeellr
rleaharrygaevrpgvvkgvrdmggvfeveteegvekaerlllcthkdptlpsllgltr
rgayidtdeggrtsyprvyaagvargkvpghaiisagdgayvavhlvsdlrgepykdhal