PDB entry 2ywk

View 2ywk on RCSB PDB site
Description: Crystal structure of RRM-domain derived from human putative RNA-binding protein 11
Class: RNA binding protein
Keywords: RRM-domain, RNA-binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2007-04-20, released 2008-04-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative RNA-binding protein 11
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57052 (Start-88)
      • expression tag (89-94)
    Domains in SCOPe 2.01: d2ywka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ywkA (A:)
    gssgssgmfpaqeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfg
    fvcfkhpesvsyaiallngirlygrpinvsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ywkA (A:)
    qeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfgfvcfkhpesvs
    yaiallngirlygrpinvsgpssg