PDB entry 2yw9

View 2yw9 on RCSB PDB site
Description: Crystal structure of TT0143 from Thermus thermophilus HB8
Class: Oxidoreductase
Keywords: Alpha and beta proteins (a/b), Oxidoreductase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-20, released 2007-05-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9a_
  • Chain 'B':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9b_
  • Chain 'C':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9c_
  • Chain 'D':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9d_
  • Chain 'E':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9e_
  • Chain 'F':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9f_
  • Chain 'G':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9g_
  • Chain 'H':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yw9h_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yw9A (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9A (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrdrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi
    mg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yw9B (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9B (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasgi
    tgevvyvdagyhimg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yw9C (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9C (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi
    mgmel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yw9D (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9D (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvgftkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvd
    agyhimg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yw9E (E:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9E (E:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdag
    yhimgm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yw9F (F:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9F (F:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhim
    gm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yw9G (G:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9G (G:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasgi
    tgevvyvdagyhimg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yw9H (H:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw9H (H:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvftkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvda
    gyhimg