PDB entry 2yw8

View 2yw8 on RCSB PDB site
Description: Crystal structure of human RUN and FYVE domain-containing protein
Class: metal binding protein
Keywords: STRUCTURE GENOMICS, FYVE domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-04-20, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RUN and FYVE domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: RUFY1, RABIP4, ZFYVE12
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96T51
  Domains in SCOPe 2.08: d2yw8a_
• Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2yw8A (A:)
  ikevnqalkghawlkddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsyp
  kpvrvcdschtlllqrcsstas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yw8A (A:)
  kddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsypkpvrvcdschtlll
  q