PDB entry 2yvm

View 2yvm on RCSB PDB site
Description: Crystal structure of NDX2 in complex with MG2+ from thermus thermophilus HB8
Deposited on 2007-04-13, released 2008-02-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ndx2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yvmA (A:)
mspwerilleeilsepvrlvkervrthtgreltyvyrpgpvaasfvlpvtergtallvrq
yrhptgkfllevpagkvdegetpeaaarrelreevgaeaetliplpsfhpqpsftavvfh
pflalkarvvtpptleegelleslelpltevyallakgeiqdastaltlfyaephlkrlg
ll