PDB entry 2yve

View 2yve on RCSB PDB site
Description: Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor CgmR
Class: transcription
Keywords: transcriptional regulator, helix-turn-helix, TetR-family, TRANSCRIPTION
Deposited on 2007-04-12, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.203
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: cgl2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvea1, d2yvea2
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: cgl2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yveb1, d2yveb2
  • Heterogens: CL, MBT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yveA (A:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipsqtelh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yveA (A:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yveB (B:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipsqtelh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yveB (B:)
    tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd
    wdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwip
    dtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelip