PDB entry 2yv8

View 2yv8 on RCSB PDB site
Description: Crystal structure of N-terminal domain of human galectin-8
Class: sugar binding protein
Keywords: two beta sheets, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2007-04-10, released 2008-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8 variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59E97 (Start-157)
      • expression tag (158-163)
    Domains in SCOPe 2.05: d2yv8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yv8A (A:)
    gssgssgmmlslnnlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqng
    ssvkpradvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdk
    fqvavngkhtllyghrigpekidtlgiygkvnihsigfsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yv8A (A:)
    nlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhf
    nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
    ghrigpekidtlgiygkvnihsigfsgpssg