PDB entry 2yv0

View 2yv0 on RCSB PDB site
Description: Structural and Thermodynamic Analyses of E. coli ribonuclease HI Variant with Quintuple Thermostabilizing Mutations
Class: hydrolase
Keywords: RNase HI, Quintuple Thermostabilizing Mutations, E. coli, HYDROLASE
Deposited on 2007-04-06, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Gene: rnhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (22)
      • engineered (61)
      • engineered (73)
      • engineered (94)
      • engineered (133)
    Domains in SCOPe 2.07: d2yv0x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yv0X (X:)
    mlkqveiftdgsclgnpgpggyaailryrgrektfsagytrttnnrmelmaaivalealk
    epcevilstdsqylrqgitqwihnwkkrgwktadgkpvknvdlwqrldaalgqhqikwew
    vkghaghpenerchelaraaamnptledtgyqvev