PDB entry 2yuv

View 2yuv on RCSB PDB site
Description: Solution Structure of 2nd Immunoglobulin Domain of Slow Type Myosin-Binding Protein C
Class: cell adhesion
Keywords: slow-type Myosin-binding protein C, Immunoglobulin domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, slow-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00872 (7-93)
      • expression tag (0-6)
      • expression tag (94-99)
    Domains in SCOPe 2.06: d2yuva1, d2yuva2, d2yuva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yuvA (A:)
    gssgssgaafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkg
    cqrilfinncqmtddseyyvtagdekcstelfvrsgpssg