PDB entry 2yuu

View 2yuu on RCSB PDB site
Description: Solution structure of the first Phorbol esters/diacylglycerol binding domain of human Protein kinase C, delta
Class: transferase
Keywords: Metal Binding Protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein kinase c delta type
  Species: Homo sapiens [TaxId:9606]
  Gene: PRKCD
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05655 (7-76)
    • expression tag (0-6)
    • expression tag (77-82)
  Domains in SCOPe 2.08: d2yuua1, d2yuua2, d2yuua3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yuuA (A:)
  gssgssgkqakihyiknhefiatffgqptfcsvckdfvwglnkqgykcrqcnaaihkkci
  dkiigrctgtaansrdtsgpssg