PDB entry 2yup

View 2yup on RCSB PDB site
Description: Solution structure of the second SH3 domain of human Vinexin
Class: cell adhesion
Keywords: Sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vinexin
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60504 (7-83)
      • expression tag (0-6)
      • expression tag (84-89)
    Domains in SCOPe 2.06: d2yupa1, d2yupa2, d2yupa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yupA (A:)
    gssgssgkpptyqvleygeavaqytfkgdlevelsfrkgehiclirkvnenwyegritgt
    grqgifpasyvqvsreprlrlcddsgpssg