PDB entry 2yuo

View 2yuo on RCSB PDB site
Description: Solution structure of the SH3 domain of mouse RUN and TBC1 domain containing 3
Class: signaling protein
Keywords: CIP85, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RUN and TBC1 domain containing 3
    Species: Mus musculus [TaxId:10090]
    Gene: Rutbc3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCZ6 (7-71)
      • expression tag (0-6)
      • expression tag (72-77)
    Domains in SCOPe 2.08: d2yuoa1, d2yuoa2, d2yuoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yuoA (A:)
    gssgssgrrakalldferhdddelgfrkndiitiisqkdehcwvgelnglrgwfpakfve
    vlderskeysiasgpssg