PDB entry 2yun

View 2yun on RCSB PDB site
Description: Solution structure of the SH3 domain of human Nostrin
Class: protein transport
Keywords: Nitric oxide synthase trafficker, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nostrin
    Species: Homo sapiens [TaxId:9606]
    Gene: NOSTRIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IVI9 (7-72)
      • expression tag (0-6)
      • expression tag (73-78)
    Domains in SCOPe 2.06: d2yuna1, d2yuna2, d2yuna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yunA (A:)
    gssgssgrlckalysfqarqddelnlekgdiviihekkeegwwfgslngkkghfpaayve
    elpsnagntatkasgpssg