PDB entry 2yun

View 2yun on RCSB PDB site
Description: Solution structure of the SH3 domain of human Nostrin
Class: protein transport
Keywords: Nitric oxide synthase trafficker, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nostrin
  Species: Homo sapiens [TaxId:9606]
  Gene: NOSTRIN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8IVI9 (7-72)
    • expression tag (0-6)
    • expression tag (73-78)
  Domains in SCOPe 2.05: d2yuna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yunA (A:)
  gssgssgrlckalysfqarqddelnlekgdiviihekkeegwwfgslngkkghfpaayve
  elpsnagntatkasgpssg