PDB entry 2yum

View 2yum on RCSB PDB site
Description: Solution structure of the Myb-like DNA-binding domain of human ZZZ3 protein
Class: transcription
Keywords: TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger ZZ-type-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ZZZ3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IYH5 (7-68)
      • expression tag (0-6)
      • expression tag (69-74)
    Domains in SCOPe 2.08: d2yuma1, d2yuma2, d2yuma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yumA (A:)
gssgssgnqlwtveeqkkleqllikyppeevesrrwqkiadelgnrtakqvasqvqkyfi
kltkagipvsgpssg