PDB entry 2yul

View 2yul on RCSB PDB site
Description: Solution structure of the HMG box of human Transcription factor SOX-17
Class: transcription
Keywords: TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor SOX-17
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6I2 (7-75)
      • expression tag (0-6)
      • expression tag (76-81)
    Domains in SCOPe 2.05: d2yula_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yulA (A:)
    gssgssgirrpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfvee
    aerlrvqhmqdhpnyksgpssg