PDB entry 2yuk

View 2yuk on RCSB PDB site
Description: solution structure of the hmg box of human myeloid/lymphoid or mixed- lineage leukemia protein 3 homolog
Deposited on 2007-04-06, released 2008-04-08
The last revision was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MLL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEZ4 (7-89)
      • expression tag (0-6)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yukA (A:)
    gssgssgnaqrstlkwekeealgematvapvlytninfpnlkeefpdwttrvkqiaklwr
    kassqerapyvqkardnraalrinkvqmsn