PDB entry 2yub

View 2yub on RCSB PDB site
Description: Solution structure of the PDZ domain from mouse LIM domain kinase
Class: transferase
Keywords: PDZ domain, LIMK-2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LIM domain kinase 2
  Species: Mus musculus [TaxId:10090]
  Gene: LIMK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O54785 (7-111)
    • expression tag (0-6)
    • expression tag (112-117)
  Domains in SCOPe 2.08: d2yuba1, d2yuba2, d2yuba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yubA (A:)
  gssgssgvqdqlpysvtlismpattecrrgfsvtvesassnyattvqvkevnrmhispnn
  rnaihpgdrileingtpvrtlrveevedaikqtsqtlqlliehdpvpqrldqsgpssg