PDB entry 2yua

View 2yua on RCSB PDB site
Description: Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein
Class: chaperone
Keywords: J domain, all helix protein, chaperone, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Williams-Beuren syndrome chromosome region 18 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: WBSCR18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LL9 (7-92)
      • expression tag (0-6)
      • expression tag (93-98)
    Domains in SCOPe 2.08: d2yuaa1, d2yuaa2, d2yuaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yuaA (A:)
gssgssgsqgdcsysrtalydllgvpstatqaqikaayyrqcflyhpdrnsgsaeaaerf
trisqayvvlgsatlrrkydrgllsdedlrgpgsgpssg