PDB entry 2yu6

View 2yu6 on RCSB PDB site
Description: Solution structure of the YTH domain in YTH domain-containing protein 2
Class: RNA binding protein
Keywords: NMR, YTH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2007-04-05, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: YTH domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: YTHDC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H6S0 (7-140)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2yu6a1, d2yu6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yu6A (A:)
  gssgssgvryfimkssnlrnleisqqkgiwsttpsnerklnrafwessivylvfsvqgsg
  hfqgfsrmsseigreksqdwgsaglggvfkvewirkeslpfqfahhllnpwndnkkvqis
  rdgqelepqvgeqllqlwerl