PDB entry 2ytv

View 2ytv on RCSB PDB site
Description: Solution structure of the fifth cold-shock domain of the human KIAA0885 protein (unr protein)
Deposited on 2007-04-05, released 2008-04-08
The last revision was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock domain-containing protein E1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0885
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75534 (7-72)
      • expression tag (0-6)
      • expression tag (73-78)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ytvA (A:)
gssgssglrratvecvkdqfgfinyevgdskklffhvkevqdgielqagdevefsvilnq
rtgkcsacnvwrvsgpssg