PDB entry 2ytc

View 2ytc on RCSB PDB site
Description: Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22
Class: transcription
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-04-05, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor RBM22
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NW64 (7-84)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2ytca1, d2ytca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ytcA (A:)
    gssgssgedktittlyvgglgdtitetdlrnhfyqfgeirtitvvqrqqcafiqfatrqa
    aevaaeksfnklivngrrlnvkwgr