PDB entry 2yta

View 2yta on RCSB PDB site
Description: Solution structure of C2H2 type Zinc finger domain 3 in Zinc finger protein 32
Class: metal binding protein
Keywords: Zinc-finger domain, C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-04-05, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 32
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF32, KOX30
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17041 (7-34)
      • expression tag (0-6)
      • expression tag (35-40)
    Domains in SCOPe 2.08: d2ytaa1, d2ytaa2, d2ytaa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ytaA (A:)
    gssgssgekpyqckecgksfsqrgslavherlhtgsgpssg