PDB entry 2yt8

View 2yt8 on RCSB PDB site
Description: Solution structure of the PDZ domain of Amyloid beta A4 precursor protein-binding family A member 3 (Neuron- specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3) (Adapter protein X11gamma)
Class: protein transport
Keywords: NMR, structure genomics, PDZ domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT
Deposited on 2007-04-05, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 precursor protein-binding family A member 3
  Species: Homo sapiens [TaxId:9606]
  Gene: APBA3
  Database cross-references and differences (RAF-indexed):
  • Uniprot O96018 (7-93)
    • expression tag (0-6)
  Domains in SCOPe 2.06: d2yt8a1, d2yt8a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yt8A (A:)
  gssgssgvttaiihrphareqlgfcvedgiicsllrggiaerggirvghriieingqsvv
  atphariiellteaygevhiktmpaatyrlltgq