PDB entry 2yt5

View 2yt5 on RCSB PDB site
Description: solution structure of the phd domain of metal-response element-binding transcription factor 2
Deposited on 2007-04-05, released 2008-04-15
The last revision was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal-response element-binding transcription factor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Mtf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02395 (7-65)
      • expression tag (0-6)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yt5A (A:)
    gssgssgvcticqeeyseapnemvicdkcgqgyhqlchtphidssvidsdekwlcrqcvf
    atttkr