PDB entry 2yt2

View 2yt2 on RCSB PDB site
Description: Solution structure of the chimera of the PTB domain of SNT-2 and 19-residue peptide (aa 1571-1589) of hALK
Deposited on 2007-04-05, released 2008-04-08
The last revision was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor substrate 3 and ALK tyrosine kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43559 (7-119)
      • expression tag (0-6)
      • expression tag (120-133)
    • Uniprot Q9UM73 (134-152)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yt2A (A:)
gssgssglnrdsvpdnhptkfkvtnvddegvelgsgvmeltqselvlhlhrreavrwpyl
clrrygydsnlfsfesgrrcqtgqgifafkcsraeeifnllqdlmqcnsinvmeepviit
sgssgssgssgssglfrlrhfpcgnvnygyqqq