PDB entry 2ysv

View 2ysv on RCSB PDB site
Description: Solution structure of C2H2 type Zinc finger domain 17 in Zinc finger protein 473
Class: metal binding protein
Keywords: Zinc finger domain, C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-04-04, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 473
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF473, KIAA1141, ZFP100
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTR7 (7-35)
      • expression tag (0-6)
      • expression tag (36-41)
    Domains in SCOPe 2.08: d2ysva1, d2ysva2, d2ysva3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ysvA (A:)
    gssgssgekpyvcqecgkaftqssclsihrrvhtgesgpssg