PDB entry 2ysm

View 2ysm on RCSB PDB site
Description: solution structure of the second and third phd domain from histone- lysine n-methyltransferase 2c (kmt2c/mll3)
Deposited on 2007-04-03, released 2007-10-09
The last revision was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MLL3, HALR, KIAA1506
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEZ4 (7-104)
      • expression tag (0-6)
      • expression tag (105-110)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ysmA (A:)
    gssgssgancavcdspgdlldqffcttcgqhyhgmcldiavtplkragwqcpeckvcqnc
    kqsgedskmlvcdtcdkgyhtfclqpvmksvptngwkckncricisgpssg