PDB entry 2ysi

View 2ysi on RCSB PDB site
Description: Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
Class: protein binding
Keywords: Transcription elongation regulator 1, CA150, FBP28, WW domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation regulator 1
  Species: Mus musculus [TaxId:10090]
  Gene: Tcerg1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CGF7 (7-39)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2ysia2, d2ysia3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ysiA (A:)
  gssgssgteeiwvenktpdgkvyyynartresawtkpdgv