PDB entry 2yse

View 2yse on RCSB PDB site
Description: solution structure of the second ww domain from the human membrane- associated guanylate kinase, ww and pdz domain-containing protein 1. magi-1
Deposited on 2007-04-03, released 2007-10-09
The last revision was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (7-53)
      • expression tag (0-6)
      • expression tag (54-59)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yseA (A:)
    gssgssgldselelpagwekiedpvygiyyvdhinrktqyenpvleakrkkqlesgpssg