PDB entry 2ysd

View 2ysd on RCSB PDB site
Description: Solution structure of the first WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1. MAGI-1
Class: protein binding
Keywords: MAGI1, WW domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-09, with a file datestamp of 2007-10-05.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: HOMO SAPIENS
    Gene: MAGI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (7-50)
      • expression tag (0-6)
      • expression tag (51-56)
    Domains in SCOP 1.75: d2ysda1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ysdA (A:)
    gssgssgaednlgplpenwemaytengevyfidhntkttswldprclnkqqsgpssg