PDB entry 2ysc

View 2ysc on RCSB PDB site
Description: Solution structure of the WW domain from the human amyloid beta A4 precursor protein-binding family B member 3, APBB3
Class: protein binding
Keywords: Fe65-like protein 2, WW domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-04-03, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family B member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95704 (7-38)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2ysca1, d2ysca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yscA (A:)
    gssgssgglppgwrkihdaagtyywhvpsgstqwqrptw