PDB entry 2ys1

View 2ys1 on RCSB PDB site
Description: Solution structure of the PH domain of Dynamin-2 from human
Class: signaling protein
Keywords: PH domain, dynamin 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-03, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynamin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: DNM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50570 (7-112)
      • expression tag (0-6)
    Domains in SCOPe 2.06: d2ys1a1, d2ys1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ys1A (A:)
    gssgssgvirrgwltinnislmkggskeywfvltaeslswykdeeekekkymlpldnlki
    rdvekgfmsnkhvfaifnteqrnvykdlrqielacdsqedvdswkasflragv