PDB entry 2yrz

View 2yrz on RCSB PDB site
Description: Solution structure of the fibronectin type III domain of human Integrin beta-4
Class: cell adhesion
Keywords: GP150, CD104 antigen, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2007-04-03, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin beta-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16144 (7-111)
      • expression tag (0-6)
      • expression tag (112-117)
    Domains in SCOPe 2.08: d2yrza1, d2yrza2, d2yrza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yrzA (A:)
gssgssgshdsrltagvpdtptrlvfsalgptslrvswqeprcerplqgysveyqllngg
elhrlnipnpaqtsvvvedllpnhsyvfrvraqsqegwgreregvitiesqvsgpssg