PDB entry 2yrj

View 2yrj on RCSB PDB site
Description: Solution structure of the C2H2-type zinc finger domain (781-813) from zinc finger protein 473
Class: cell cycle
Keywords: C2H2-type zinc finger, Zinc finger protein 473, Zinc finger protein 100 homolog Zfp-100, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE
Deposited on 2007-04-02, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 473
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF473
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTR7 (7-39)
      • expression tag (0-6)
      • expression tag (40-45)
    Domains in SCOPe 2.08: d2yrja1, d2yrja2, d2yrja3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yrjA (A:)
    gssgssgtgekpyrcgecgkafaqkanltqhqrihtgekpsgpssg