PDB entry 2yrb

View 2yrb on RCSB PDB site
Description: Solution structure of the first C2 domain from human KIAA1005 protein
Class: structural genomics, unknown function
Keywords: beta sandwich, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-04-02, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein fantom
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68CZ1 (7-149)
      • expression tag (0-6)
      • see remark 999 (7)
      • expression tag (150-155)
    Domains in SCOPe 2.08: d2yrba1, d2yrba2, d2yrba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yrbA (A:)
    gssgssgdetihlergenlfeihinkvtfssevlqasgdkepvtfctyafydfelqttpv
    vrglhpeynftsqylvhvndlflqyiqkntitlevhqaysteyetiaacqlkfheileks
    grifctasligtkgdipnfgtveywfrlrvsgpssg