PDB entry 2yr3

View 2yr3 on RCSB PDB site
Description: Solution structure of the fourth Ig-like domain from myosin light chain kinase, smooth muscle
Class: transferase
Keywords: Ig domain, Myosin light chain kinase,smooth muscle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-04-02, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myosin light chain kinase, smooth muscle
  Species: Homo sapiens [TaxId:9606]
  Gene: MYLK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15746 (7-98)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2yr3a1, d2yr3a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yr3A (A:)
  gssgssgmevapsfssvlkdcaviegqdfvlqcsvrgtpvpritwllngqpiqyarstce
  agvaelhiqdalpedhgtytclaenalgqvscsawvtvh